Blue Fluorescent Protein (BFP)

Blue Fluorescent Protein (BFP) is available at Gentaur for Next week delivery.

Fluorescent protein ideal for subcellular labeling/visualization

Biomolecule/Target:

Alternates names: BFP, Blue Fluorescent Protein

Synonyms: BFP, Blue Fluorescent Protein

Background Information: The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Reconstitution Instructions: Reconstitute with dH₂O to 1 mg/ml

NCBI Gene Symbol:

Gene ID:

NCBI Accession: