Description
Blue Fluorescent Protein (BFP) is available at Gentaur for Next week delivery.
Fluorescent protein ideal for subcellular labeling/visualization
Biomolecule/Target:
Alternates names: BFP, Blue Fluorescent Protein
Synonyms: BFP, Blue Fluorescent Protein
Background Information: The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK
Reconstitution Instructions: Reconstitute with dH₂O to 1 mg/ml
NCBI Gene Symbol:
Additional Information
Size: |
5 mg |
Adwords: |
Yes |
Country of Manufacturing Origin: |
USA |
Country of Animal Origin: |
USA |
Recombinant: |
Yes |
Source: |
E. coli |
Purity by SDS-PAGE: |
≥97% |
Assay: |
SDS-PAGE |
Purity: |
≥97% |
Assay 2: |
HPLC |
Endotoxin Level: |
<0.1 ng/μg |
Activity (Specifications/test method): |
N/A |
Biological activity: |
N/A |
Results: |
N/A |
Molecular Weight: |
29.0 kDa |
Storage Temperature: |
-20°C |
Shelf Life: |
12 months |
Concentration: |
N/A |
Appearance: |
Lyophilized protein |
Handling: |
Centrifuge the vial prior to opening. |