Biomatik Antibodies
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody
- SKU:
- CAU26253
- Availability:
- Next week delivery
Frequently bought together:
Description
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibodyis available at Gentaur for next week delivery.
Specificity:
Alternative Names: P31996
Immunogen: SCARD1 (Ala27-Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA)
Technical Notes: For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Application: WB; IHC; ICC; IP.
Restriction:
Comments: Buffer Formulation: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.; Western blotting: 0.5-2µg/mL; 1:500-2000; Immunohistochemistry: 5-20µg/mL; 1:50-200; Immunocytochemistry: 5-20µg/mL; 1:50-200; Optimal working dilutions must be determined by end user.
Additional Information
Species Reactivity: |
Mus musculus (Mouse) |
Size: |
100ug |
Host: |
Rabbit |
Clonality: |
Rabbit Polyclonal |
Concentration: |
-20°C |
Storage: |
1 year |
Expiry Date: |
Ice packs |
Shipping Condition: |
Conjugation service and the corresponding secondary antibody are available. |
Purification: |
1mg/ml |